Tapez / cliquez sur l'image pour voir plus de RealViewsTM
30,35 €
par mug
 

Tropical Beach Sunset Coffee Mug

Qté:
Mug classique
+2,00 €
+4,00 €
+10,75 €
+11,85 €
+16,45 €
+20,25 €

Autres designs de cette catégorie

La Promesse Zazzle

  • Illustration d'un paquet cadeau emballé, surmonté de cœurs, représentant la « garantie 100 % satisfaction » de Zazzle.

    Garantie Coup de Coeur

    Vous ne l'aimez pas ? Nous le reprenons ! 30 jours pour choisir, notre "Garantie 100% coup de cœur".

  • Illustration d'un camion de livraison transportant un colis emballé, symbolisant la facilité des expéditions internationales avec Zazzle.

    Livraison Internationale Simplifiée

    Expédition sans soucis, sans frais cachés. Nous couvrons les frais de douane.

  • Illustration d'un bouclier, symbolisant la sécurité du site Zazzle.

    Achats Sécurisés Garantis

    Paiement 100% sécurisé grâce au cryptage SSL.

A propos de Tasses

Vendu (e) par

Modèle: Mug classique

Offrez une tasse personnalisée de Zazzle à quelqu'un qui vous est cher, ou faites-vous plaisir avec un motif qui vous rend heureux ou vous fait rire. Créez votre propre tasse photo, parcourez notre collection des tasses les plus drôles, personnalisez votre tasse avec un monogramme ou exprimez-vous avec l'un de nos 10 millions de motifs.

  • Disponible en 325 ml ou 445 ml
  • Dimensions :
    • 325 ml : 8,1 cm de diamètre x 9,7 cm de hauteur
    • 445 ml : 8,6 cm de diamètre x 11,4 cm de hauteur
  • Compatible micro-ondes et lave-vaisselle
  • Faites attention en sortant la tasse du micro-ondes. Utilisez un manique ou un gant si elle est trop chaude au toucher. Ne pas mettre de tasse vide au micro-ondes
  • Construction solide en céramique
  • Conforme aux exigences de la FDA en matière de sécurité alimentaire
  • Imprimé à la demande à Reno, Nevada
  • Ne pas trop remplir et faire attention aux liquides chauds qui peuvent brûler
  • Tenir hors de portée des enfants lorsque la tasse est remplie de liquide chaud

À propos de ce design

Tropical Beach Sunset Coffee Mug

Tropical Beach Sunset Coffee Mug

Bring the relaxing vibes of the beach right to your morning routine with this Tropical Beach Sunset Coffee Mug. Featuring a beautifully minimalist design of a palm tree, calm waves, and a golden sun setting behind a distant mountain, this mug is a perfect escape in ceramic form. Whether you're starting your day or winding down in the evening, this mug evokes the warmth and tranquility of a seaside getaway. The soft, earthy colors paired with a deep navy background create a peaceful contrast that feels both soothing and stylish. The design is clean and artistic, making it ideal for coastal decor lovers, beach dreamers, and anyone who enjoys a little sunshine in their everyday life. It's a perfect blend of nature and design—simple, serene, and endlessly calming. Made from high-quality ceramic, this mug is sturdy and comfortable to hold. It’s microwave and dishwasher safe, which means it’s just as practical as it is beautiful. The wraparound print ensures you get a view of the tropical artwork from every angle, and the glossy finish gives it a polished, modern look. Perfect for sipping coffee, tea, or hot chocolate, this mug is great for home, office, or as a gift for a beach lover. Whether you're reminiscing about your last vacation or dreaming about the next one, this mug serves as a daily reminder to slow down and enjoy the little moments. Gift it for birthdays, holidays, housewarmings, or just because. It’s a thoughtful and versatile piece that suits anyone with a love for palm trees, ocean breezes, and peaceful sunset views. Let this mug transport you to sandy shores and golden skies—one sip at a time.

Avis des clients

4.7 sur 5 étoiles235 Nombres de Commentaires
192 avis au total avec 5 étoiles31 avis au total avec 4 étoiles3 avis au total avec 3 étoiles1 avis au total avec 2 étoiles8 avis au total avec 1 étoiles
235 Commentaires
Avis sur des produits similaires
5 sur 5 étoiles
Par A.8 décembre 2025Achat sécurisé
Mug classique, 325 ml
Beautiful mug with a cute pygmy marmoset. Thank you for the care taken in the manufacturing and shipping.
4 sur 5 étoiles
Par Da V.13 février 2021Achat sécurisé
Mug classique, 325 ml
Programme d'évaluation de Zazzle
Três bien est paraît une très bonne qualité. Nickel rien à dire comme défaut
5 sur 5 étoiles
Par Natacha D.14 avril 2019Achat sécurisé
Mug classique, 325 ml
Avis du créateur
Arrived to France well packed and perfectly protected! I designed it so I ordered one for myself to see the quality and one for a client leaving near so she doesn't have to pay the shipping. We both are satisfied with the quality. The touch is smooth in hand and glossy look just as it should be. Loved the product! Happy with how it looks

Tags

Tasses
tropicalbeachsunsetcoffeemugdesignpalmtreeandwavesceramiccupstyleminimalistseasidedrinkwareforhomecoastalscenemugwithsunsetartworkbeachsunsetillustrationceramiccoffeecupoceanvibesmugforrelaxingmomentsnavybluebackgroundbeachthemedmugvacationinspiredhotbeveragemugdesignpalmcoastmountainscenerycoffeecupgiftseasidetravelvibesdrinkwarecollection
Tous les produits
tropicalbeachsunsetcoffeemugdesignpalmtreeandwavesceramiccupstyleminimalistseasidedrinkwareforhomecoastalscenemugwithsunsetartworkbeachsunsetillustrationceramiccoffeecupoceanvibesmugforrelaxingmomentsnavybluebackgroundbeachthemedmugvacationinspiredhotbeveragemugdesignpalmcoastmountainscenerycoffeecupgiftseasidetravelvibesdrinkwarecollection

Autres infos

Identification produit : 256309746672455438
Créé le : 17/07/2025 19:01
Note : G